Tested laboratory quality >99% purity Fast & secure shipping
Go to homepage
€0.00
Skip image gallery
3 x IGF1LR3 1mg + 1 x BAC Water 10ml

3 x IGF1LR3 1mg + 1 x BAC Water 10ml

€299.00

Prices incl. VAT plus shipping costs

Free shipping

Available

Product number: BW002

🖤 BLACK WEEKEND ANGEBOT 🖤

3 x IGF1LR3 1mg + 1 x BAC Water 10ml

Rekombinantes Peptidanalogon zur Untersuchung von Zellwachstum, Signaltransduktion und Rezeptoraktivierung in präklinischen Forschungsmodellen.

Allgemeine Beschreibung

IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) ist ein rekombinantes Peptidanalogon des humanen IGF-1 mit einer verlängerten Aminosäuresequenz und einer modifizierten dritten Position (Arg statt Glu). Diese strukturelle Modifikation reduziert die Bindungsaffinität zu IGF-Bindungsproteinen (IGFBPs) und ermöglicht in Forschungsmodellen eine verlängerte Aktivitätsdauer. IGF-1 LR3 wird in der wissenschaftlichen Grundlagenforschung eingesetzt, um Signalmechanismen zu untersuchen, die an Zellwachstum, Differenzierung und Proteinbiosynthese beteiligt sind.

Chemische Eigenschaften
  • Reinheit: ≥ 99 % (HPLC-geprüft)
  • Form: lyophilisiertes Pulver
  • Sequenz: MFPAMPLLSRAVLLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKA – (E)LR – GSAGKSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Molekulargewicht: ca. 9117 Da
  • Löslichkeit: wasserlöslich nach Rekonstitution
Forschungsrelevanz

In präklinischen Modellen wird IGF-1 LR3 eingesetzt, um die Aktivierung der IGF-1-Rezeptoren und nachgeschalteter Signalwege (PI3K/Akt- und MAPK-Kaskaden) zu untersuchen. Das Peptid dient ausschließlich der Grundlagenforschung und der Analyse Peptid-vermittelter Zellprozesse wie Wachstum, Differenzierung und Stoffwechselregulation.

Lagerung & Handhabung

Kühl (2 – 8 °C) und trocken lagern. Nach Rekonstitution aliquotieren und bei −20 °C aufbewahren, um die strukturelle Stabilität des Peptids zu bewahren.

Analysenzertifikat (COA)

Jede Charge von IGF-1 LR3 wird mittels HPLC- und Massenspektrometrie-Analysen verifiziert. Das entsprechende COA steht chargenbezogen im Downloadbereich zur Verfügung.

Hinweis & Haftungsausschluss

Dieses Produkt ist ausschließlich für Forschungszwecke bestimmt. Nicht zur Anwendung am Menschen oder Tier, nicht für diagnostische oder therapeutische Zwecke geeignet.

0 of 0 reviews

Leave a review!

Share your experiences with other customers.

Skip product gallery

Das könnte Sie auch interessieren:

CJC-1295 / Ipamorelin Blend (5 mg / 5 mg) – Research peptide
CJC-1295 / Ipamorelin Blend (5 mg / 5 mg) – Research peptide
Combined peptide formulation for studying synergistic signaling mechanisms in growth hormone release and receptor activation. General Description The CJC-1295 / Ipamorelin Blend combines two synthetic peptides used in scientific studies to analyze peptide-mediated secretion mechanisms. CJC-1295 is a modified GHRH analogue (Growth Hormone Releasing Hormone), while Ipamorelin is a synthetic GHRP agonist (Growth Hormone Releasing Peptide). Together, they serve as an experimental model for investigating parallel signaling pathways, receptor activation, and peptide synergy within endocrine systems. Chemical Properties Purity: ≥ 99 % (HPLC-tested) Form: lyophilized powder Content: 5 mg CJC-1295 + 5 mg Ipamorelin Sequences: CJC-1295: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH₂ Solubility: water-soluble after reconstitution Research Relevance In preclinical research models, the CJC-1295 / Ipamorelin Blend is used to study combined peptide signaling, receptor cascades, and endocrine feedback mechanisms. It is intended exclusively for fundamental research and the structural analysis of synergistic peptide effects at the molecular level. Storage & Handling Store in a cool (2 – 8 °C), dry place. After reconstitution, aliquot and store at −20 °C to preserve the stability of both peptide components. Certificate of Analysis (COA) Each batch of the CJC-1295 / Ipamorelin Blend is verified by HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

€74.99
Details
CJC-1295 DAC (5 mg) – Research peptide
CJC-1295 DAC (5 mg) – Research peptide
Synthetic peptide analogue for the investigation of signal transduction and secretion mechanisms in preclinical research models. General Description CJC-1295 DAC (Drug Affinity Complex) is a synthetic peptide based on a modified GHRH analogue (Growth Hormone Releasing Hormone). In scientific research environments, it is used to study peptide–receptor binding mechanisms, signal transduction, and hormone-like secretion processes at the molecular level. The DAC modification (Drug Affinity Complex) extends peptide stability and allows detailed analysis of receptor interaction over extended periods. Chemical Properties Purity: ≥ 99 % (HPLC-tested) Form: lyophilized powder Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ Molecular weight: approx. 3647 Da Modification: DAC (Drug Affinity Complex) Solubility: water-soluble after reconstitution Research Relevance In preclinical models, CJC-1295 DAC is used to analyze the dynamics of GHRH analogues, receptor activation, and peptide-mediated signal transduction. It is intended exclusively for basic research and molecular characterization of peptide-based interactions within endocrine signaling networks. Storage & Handling Store in a cool (2 – 8 °C), dry place. After reconstitution, aliquot and store at −20 °C to maintain peptide stability and structural integrity. Certificate of Analysis (COA) Each batch of CJC-1295 DAC is verified through HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

€42.99
Details