Immunregulation & Homöostase | Ultimate Biolabs

To be able to use the full range of Shopware 6, we recommend activating Javascript in your browser.

Tested laboratory quality >99% purity Fast & secure shipping

Immune Regulation & Homeostasis

Research on immunological signaling pathways, cellular communication, and equilibrium processes.

Studies analyze receptor binding, cytokine patterns, and feedback loops involved in maintaining systemic stability.

Note: For research and laboratory use only.

LL-37 (5 mg) – Research Peptide

LL-37 (5 mg) – Research Peptide

Cationic peptide fragment for the investigation of innate defense mechanisms and cellular signaling processes in research models. General Description LL-37 is an endogenous peptide derived from the C-terminal region of the human cathelicidin precursor protein (hCAP18). In scientific research settings, it is used as a model molecule to analyze mechanisms of cell communication, immune response, and molecular signal transduction. Due to its amphipathic structure and positive net charge, LL-37 plays an important role in preclinical studies investigating cellular interactions and membrane processes. Chemical Properties Purity: ≥ 99% (HPLC-tested) Form: lyophilized powder Sequence: [LL-37, 37 aa] Molecular weight: approx. 4493 Da Solubility: water-soluble after reconstitution Research Relevance LL-37 is used in preclinical models to study mechanisms of cellular defense, immune regulation, and signal transduction. The peptide is intended exclusively for basic research and for the molecular characterization of antimicrobial peptide interactions with cell membranes. Storage & Handling Store in a cool (2–8 °C), dry place. After reconstitution, aliquot and keep at −20 °C to preserve the structural integrity of the peptide. Certificate of Analysis (COA) Each batch of LL-37 is verified by HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Thymosin Alpha-1 (10 mg) – Research Peptide

Thymosin Alpha-1 (10 mg) – Research Peptide

Synthetic peptide fragment for the investigation of immunological signaling pathways and regulatory mechanisms in preclinical research models. General Description Thymosin Alpha-1 (Tα1) is a synthetic analogue of a natural peptide fragment originally isolated from thymus extracts. In scientific research settings, it is used to analyze molecular signaling mechanisms and cellular responses within the immune system. Due to its well-characterized sequence and structure, Thymosin Alpha-1 serves as a relevant model molecule for studying peptide-mediated immune and regulatory processes. Chemical Properties Purity: ≥ 99% (HPLC-tested) Form: lyophilized powder Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn Molecular weight: approx. 3108 Da Solubility: water-soluble after reconstitution Research Relevance Thymosin Alpha-1 is used in preclinical research models to investigate regulatory peptide mechanisms, cellular signal transduction, and immune cell interactions. It is intended exclusively for basic research and molecular characterization of immunoregulatory peptide processes. Storage & Handling Store in a cool (2–8 °C) and dry place. After reconstitution, aliquot and store at −20 °C to maintain the structural integrity of the peptide. Certificate of Analysis (COA) Each batch of Thymosin Alpha-1 is verified using HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.