LL-37 (5 mg) – Research Peptide
- 🔬 Tested laboratory quality
- 💎 >99% purity
- 🚚 Fast & secure shipping
Cationic peptide fragment for the investigation of innate defense mechanisms and cellular signaling processes in research models.
General Description
LL-37 is an endogenous peptide derived from the C-terminal region of the human cathelicidin precursor protein (hCAP18). In scientific research settings, it is used as a model molecule to analyze mechanisms of cell communication, immune response, and molecular signal transduction. Due to its amphipathic structure and positive net charge, LL-37 plays an important role in preclinical studies investigating cellular interactions and membrane processes.
Chemical Properties
- Purity: ≥ 99% (HPLC-tested)
- Form: lyophilized powder
- Sequence: [LL-37, 37 aa]
- Molecular weight: approx. 4493 Da
- Solubility: water-soluble after reconstitution
Research Relevance
LL-37 is used in preclinical models to study mechanisms of cellular defense, immune regulation, and signal transduction. The peptide is intended exclusively for basic research and for the molecular characterization of antimicrobial peptide interactions with cell membranes.
Storage & Handling
Store in a cool (2–8 °C), dry place. After reconstitution, aliquot and keep at −20 °C to preserve the structural integrity of the peptide.
Certificate of Analysis (COA)
Each batch of LL-37 is verified by HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch.
Notice & Disclaimer
This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.
| Manufacturing method: | Synthetic |
|---|---|
| Product type: | Research peptide |
| Purity: | ≥ 99 % |
| Storage recommendation: | 2–8 °C / −20 °C |
| Form: | Lyophilized powder |
| Verwendungszweck: | Forschung |
Login
