Skip to main content Skip to search Skip to main navigation
Tested laboratory quality >99% purity Fast & secure shipping

Cationic peptide fragment for the investigation of innate defense mechanisms and cellular signaling processes in research models.

General Description

LL-37 is an endogenous peptide derived from the C-terminal region of the human cathelicidin precursor protein (hCAP18). In scientific research settings, it is used as a model molecule to analyze mechanisms of cell communication, immune response, and molecular signal transduction. Due to its amphipathic structure and positive net charge, LL-37 plays an important role in preclinical studies investigating cellular interactions and membrane processes.

Chemical Properties
  • Purity: ≥ 99% (HPLC-tested)
  • Form: lyophilized powder
  • Sequence: [LL-37, 37 aa]
  • Molecular weight: approx. 4493 Da
  • Solubility: water-soluble after reconstitution
Research Relevance

LL-37 is used in preclinical models to study mechanisms of cellular defense, immune regulation, and signal transduction. The peptide is intended exclusively for basic research and for the molecular characterization of antimicrobial peptide interactions with cell membranes.

Storage & Handling

Store in a cool (2–8 °C), dry place. After reconstitution, aliquot and keep at −20 °C to preserve the structural integrity of the peptide.

Certificate of Analysis (COA)

Each batch of LL-37 is verified by HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch.

Notice & Disclaimer

This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Properties "LL-37 (5 mg) – Research Peptide"
Manufacturing method: Synthetic
Product type: Research peptide
Purity: ≥ 99 %
Storage recommendation: 2–8 °C / −20 °C
Form: Lyophilized powder
Verwendungszweck: Forschung

0 of 0 reviews

Average rating of 0 out of 5 stars

Leave a review!

Share your experiences with other customers.


Skip product gallery

You may also be interested in:

Thymosin Alpha-1 (10 mg) – Research Peptide
Synthetic peptide fragment for the investigation of immunological signaling pathways and regulatory mechanisms in preclinical research models. General Description Thymosin Alpha-1 (Tα1) is a synthetic analogue of a natural peptide fragment originally isolated from thymus extracts. In scientific research settings, it is used to analyze molecular signaling mechanisms and cellular responses within the immune system. Due to its well-characterized sequence and structure, Thymosin Alpha-1 serves as a relevant model molecule for studying peptide-mediated immune and regulatory processes. Chemical Properties Purity: ≥ 99% (HPLC-tested) Form: lyophilized powder Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn Molecular weight: approx. 3108 Da Solubility: water-soluble after reconstitution Research Relevance Thymosin Alpha-1 is used in preclinical research models to investigate regulatory peptide mechanisms, cellular signal transduction, and immune cell interactions. It is intended exclusively for basic research and molecular characterization of immunoregulatory peptide processes. Storage & Handling Store in a cool (2–8 °C) and dry place. After reconstitution, aliquot and store at −20 °C to maintain the structural integrity of the peptide. Certificate of Analysis (COA) Each batch of Thymosin Alpha-1 is verified using HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Regular price: €64.99
KPV (10 mg) – Research peptide
Short tripeptide for studying cellular communication and signaling processes in preclinical research models. General Description KPV is a synthetic tripeptide derived from the C-terminal sequence of α-Melanocyte-Stimulating Hormone (α-MSH). In scientific studies, it is used to investigate molecular signaling pathways, receptor binding, and peptide–protein interactions related to the regulation of cellular responses and homeostasis. Due to its simple structure and high stability, KPV serves as a model peptide for analyzing biochemical peptide mechanisms. Chemical Properties Purity: ≥ 99 % (HPLC-tested) Form: lyophilized powder Sequence: Lys-Pro-Val Molecular weight: approx. 341 Da Solubility: water-soluble after reconstitution Research Relevance In preclinical models, KPV is used to study peptide-mediated signaling pathways, receptor interactions, and cellular regulatory mechanisms. It is intended exclusively for basic research and structural characterization of tripeptide-dependent molecular processes. Storage & Handling Store in a cool (2 – 8 °C), dry place. After reconstitution, aliquot and store at −20 °C to maintain the structural stability of the peptide over time. Certificate of Analysis (COA) Each batch of KPV is verified through HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Regular price: €49.99
Discount -20
BPC-157 (10 mg) – Research Peptide
Synthetic pentadecapeptide for the investigation of cellular signaling mechanisms and tissue processes in preclinical research models. General Description BPC-157 (Body Protection Compound-157) is a synthetic peptide derived from a sequence of the naturally occurring BPC protein. In scientific research environments, it is used to examine molecular mechanisms of cell communication, angiogenesis, and signaling related to tissue organization. Due to its sequence stability, BPC-157 serves as a model molecule for analyzing cellular regeneration processes at the biochemical level. Chemical Properties Purity: ≥ 99 % (HPLC-tested) Form: lyophilized powder Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val Molecular Weight: approx. 1419 Da Solubility: water-soluble after reconstitution Research Relevance In preclinical models, BPC-157 is utilized to analyze biochemical signaling pathways, cell migration, and peptide–protein interactions in the context of tissue organization. The peptide is intended exclusively for basic research and structural characterization of cellular response mechanisms. Storage & Handling Store refrigerated (2 – 8 °C) and dry. After reconstitution, aliquot and store at −20 °C to preserve peptide structural integrity. Certificate of Analysis (COA) Each batch of BPC-157 is verified through HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Sale price: €39.99 Regular price: €49.99 (20% saved)
Discount -25
TB-500 (Thymosin Beta-4) (10 mg) – Research Peptide
Synthetic peptide analogue for the investigation of cellular regeneration and structural processes in preclinical models. General Description TB-500 is the synthetic form of endogenous Thymosin Beta-4, a natural peptide found in various human tissues. In scientific research environments, TB-500 is used to analyze cellular processes such as migration, structural organization, and cytoskeletal dynamics. Due to its peptide sequence and high stability, TB-500 is often utilized to study actin-binding mechanisms at the molecular level. Chemical Properties Purity: ≥ 99 % (HPLC-tested) Form: lyophilized powder Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Asn-Lys Molecular Weight: approx. 4963 Da Solubility: water-soluble after reconstitution Research Relevance In preclinical studies, TB-500 is used to investigate mechanisms of cell migration, tissue organization, and wound-related processes at the molecular level. It is intended solely for basic research and the structural characterization of peptide-protein interactions within cellular physiology. Storage & Handling Store cool (2 – 8 °C) and dry. After reconstitution, aliquot and store at −20 °C to maintain stability and structural integrity of the peptide. Certificate of Analysis (COA) Each batch of TB-500 is verified by HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Sale price: €59.99 Regular price: €79.99 (25% saved)