Skip to main content Skip to search Skip to main navigation
Tested laboratory quality >99% purity Fast & secure shipping
Save with our bundle offers
+
Thymosin Alpha-1 (10 mg) – Research Peptide
BAC Water (10 ml) – Laboratory Reagent
Instead of: €74.98 (15% saved)
Price for all: €63.73 %
Details

Synthetic peptide fragment for the investigation of immunological signaling pathways and regulatory mechanisms in preclinical research models.

General Description

Thymosin Alpha-1 (Tα1) is a synthetic analogue of a natural peptide fragment originally isolated from thymus extracts. In scientific research settings, it is used to analyze molecular signaling mechanisms and cellular responses within the immune system. Due to its well-characterized sequence and structure, Thymosin Alpha-1 serves as a relevant model molecule for studying peptide-mediated immune and regulatory processes.

Chemical Properties
  • Purity: ≥ 99% (HPLC-tested)
  • Form: lyophilized powder
  • Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn
  • Molecular weight: approx. 3108 Da
  • Solubility: water-soluble after reconstitution
Research Relevance

Thymosin Alpha-1 is used in preclinical research models to investigate regulatory peptide mechanisms, cellular signal transduction, and immune cell interactions. It is intended exclusively for basic research and molecular characterization of immunoregulatory peptide processes.

Storage & Handling

Store in a cool (2–8 °C) and dry place. After reconstitution, aliquot and store at −20 °C to maintain the structural integrity of the peptide.

Certificate of Analysis (COA)

Each batch of Thymosin Alpha-1 is verified using HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch.

Notice & Disclaimer

This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Properties "Thymosin Alpha-1 (10 mg) – Research Peptide"
Manufacturing method: Synthetic
Product type: Research peptide
Purity: ≥ 99 %
Storage recommendation: 2–8 °C / −20 °C
Form: Lyophilized powder
Verwendungszweck: Forschung

0 of 0 reviews

Average rating of 0 out of 5 stars

Leave a review!

Share your experiences with other customers.


Skip product gallery

You may also be interested in:

LL-37 (5 mg) – Research Peptide
Cationic peptide fragment for the investigation of innate defense mechanisms and cellular signaling processes in research models. General Description LL-37 is an endogenous peptide derived from the C-terminal region of the human cathelicidin precursor protein (hCAP18). In scientific research settings, it is used as a model molecule to analyze mechanisms of cell communication, immune response, and molecular signal transduction. Due to its amphipathic structure and positive net charge, LL-37 plays an important role in preclinical studies investigating cellular interactions and membrane processes. Chemical Properties Purity: ≥ 99% (HPLC-tested) Form: lyophilized powder Sequence: [LL-37, 37 aa] Molecular weight: approx. 4493 Da Solubility: water-soluble after reconstitution Research Relevance LL-37 is used in preclinical models to study mechanisms of cellular defense, immune regulation, and signal transduction. The peptide is intended exclusively for basic research and for the molecular characterization of antimicrobial peptide interactions with cell membranes. Storage & Handling Store in a cool (2–8 °C), dry place. After reconstitution, aliquot and keep at −20 °C to preserve the structural integrity of the peptide. Certificate of Analysis (COA) Each batch of LL-37 is verified by HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Regular price: €37.99
KPV (10 mg) – Research peptide
Short tripeptide for studying cellular communication and signaling processes in preclinical research models. General Description KPV is a synthetic tripeptide derived from the C-terminal sequence of α-Melanocyte-Stimulating Hormone (α-MSH). In scientific studies, it is used to investigate molecular signaling pathways, receptor binding, and peptide–protein interactions related to the regulation of cellular responses and homeostasis. Due to its simple structure and high stability, KPV serves as a model peptide for analyzing biochemical peptide mechanisms. Chemical Properties Purity: ≥ 99 % (HPLC-tested) Form: lyophilized powder Sequence: Lys-Pro-Val Molecular weight: approx. 341 Da Solubility: water-soluble after reconstitution Research Relevance In preclinical models, KPV is used to study peptide-mediated signaling pathways, receptor interactions, and cellular regulatory mechanisms. It is intended exclusively for basic research and structural characterization of tripeptide-dependent molecular processes. Storage & Handling Store in a cool (2 – 8 °C), dry place. After reconstitution, aliquot and store at −20 °C to maintain the structural stability of the peptide over time. Certificate of Analysis (COA) Each batch of KPV is verified through HPLC and mass spectrometry analyses. The corresponding COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Regular price: €49.99
Epithalon (Epitalon) (10 mg) – Research Peptide
Tetrapeptide for the investigation of cellular signaling pathways and regulatory mechanisms in experimental models. General Description Epithalon, also referred to as Epitalon, is a synthetic tetrapeptide composed of the amino acid sequence Ala-Glu-Asp-Gly. In scientific research, it is utilized as a model molecule to analyze processes related to cell regulation, protein synthesis, and gene expression. Due to its short peptide structure, Epithalon is frequently studied as an example of regulatory peptide mechanisms at the molecular level. Chemical Properties Purity: ≥ 99% (HPLC-tested) Form: lyophilized powder Sequence: Ala-Glu-Asp-Gly Molecular Weight: approx. 390 Da Solubility: water-soluble after reconstitution Research Relevance Epithalon is applied in preclinical research models to explore signaling pathways associated with cell cycle and protein synthesis regulation. It is intended solely for basic research and the molecular characterization of peptide-mediated cellular mechanisms. Storage & Handling Store in a cool (2 – 8 °C), dry environment. After reconstitution, aliquot and keep at −20 °C to maintain the structural integrity of the peptide. Certificate of Analysis (COA) Each batch of Epithalon is verified using HPLC and mass spectrometry analyses. The respective COA is available for download per batch. Notice & Disclaimer This product is intended for research purposes only. Not for human or animal use, and not suitable for diagnostic or therapeutic applications.

Regular price: €39.99